CD41/ITGA2B Rabbit mAb, Clone: [ARC0620], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11490S
Article Name: CD41/ITGA2B Rabbit mAb, Clone: [ARC0620], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11490S
Supplier Catalog Number: CNA11490S
Alternative Catalog Number: MBL-CNA11490S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD41/ITGA2B (P08514).
Conjugation: Unconjugated
Alternative Names: GT, GT1, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16, PPP1R93
Clonality: Monoclonal
Clone Designation: [ARC0620]
Molecular Weight: 113kDa
NCBI: 3674
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLL
Target: ITGA2B
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200