Lamin B1 Rabbit mAb, Clone: [ARC0621], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11495S
Article Name: Lamin B1 Rabbit mAb, Clone: [ARC0621], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11495S
Supplier Catalog Number: CNA11495S
Alternative Catalog Number: MBL-CNA11495S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700).
Conjugation: Unconjugated
Alternative Names: LMN, ADLD, LMN2, LMNB, MCPH26
Clonality: Monoclonal
Clone Designation: [ARC0621]
Molecular Weight: 66kDa
NCBI: 4001
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI
Target: LMNB1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200