ALDH2 Rabbit mAb, Clone: [ARC0623], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11500S
Article Name: ALDH2 Rabbit mAb, Clone: [ARC0623], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11500S
Supplier Catalog Number: CNA11500S
Alternative Catalog Number: MBL-CNA11500S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALDH2 (P05091).
Conjugation: Unconjugated
Alternative Names: ALDM, ALDHI, ALDH-E2
Clonality: Monoclonal
Clone Designation: [ARC0623]
Molecular Weight: 56kDa
NCBI: 217
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPAL
Target: ALDH2
Application Dilute: WB: WB,1:500 - 1:1000