LOX Rabbit mAb, Clone: [ARC0624], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11504S
Article Name: LOX Rabbit mAb, Clone: [ARC0624], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11504S
Supplier Catalog Number: CNA11504S
Alternative Catalog Number: MBL-CNA11504S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300).
Conjugation: Unconjugated
Alternative Names: AAT10
Clonality: Monoclonal
Clone Designation: [ARC0624]
Molecular Weight: 47kDa
NCBI: 4015
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Target: LOX
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000