E-Cadherin Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11509S
| Article Name: |
E-Cadherin Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11509S |
| Supplier Catalog Number: |
CNA11509S |
| Alternative Catalog Number: |
MBL-CNA11509S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
UVO, CDHE, ECAD, LCAM, Arc-1, BCDS1, CD324 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
97kDa |
| NCBI: |
999 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR |
| Target: |
CDH1 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
