E-Cadherin Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11509S
Article Name: |
E-Cadherin Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA11509S |
Supplier Catalog Number: |
CNA11509S |
Alternative Catalog Number: |
MBL-CNA11509S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
UVO, CDHE, ECAD, LCAM, Arc-1, BCDS1, CD324 |
Clonality: |
Polyclonal |
Molecular Weight: |
97kDa |
NCBI: |
999 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR |
Target: |
CDH1 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |