CELF1 Rabbit mAb, Clone: [ARC1866], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1150S
Article Name: CELF1 Rabbit mAb, Clone: [ARC1866], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1150S
Supplier Catalog Number: CNA1150S
Alternative Catalog Number: MBL-CNA1150S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CELF1 (Q92879).
Conjugation: Unconjugated
Alternative Names: CUGBP, NAB50, NAPOR, CUG-BP, CUGBP1, hNab50, BRUNOL2, EDEN-BP
Clonality: Monoclonal
Clone Designation: [ARC1866]
Molecular Weight: 52kDa
NCBI: 10658
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE
Target: CELF1
Application Dilute: WB: WB,1:500 - 1:2000