RRM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1152S
Article Name: RRM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1152S
Supplier Catalog Number: CNA1152S
Alternative Catalog Number: MBL-CNA1152S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 593-792 of human RRM1 (NP_001024.1).
Conjugation: Unconjugated
Alternative Names: R1, RR1, RIR1
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 6240
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Target: RRM1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000