[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb, Clone: [ARC50558], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11532P
Article Name: [KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb, Clone: [ARC50558], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11532P
Supplier Catalog Number: CNA11532P
Alternative Catalog Number: MBL-CNA11532P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).
Conjugation: Unconjugated
Alternative Names: FH3, PC9, FHCL3, NARC1, LDLCQ1, NARC-1, HCHOLA3
Clonality: Monoclonal
Clone Designation: [ARC50558]
Molecular Weight: 74kDa
NCBI: 255738
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
Target: PCSK9
Application Dilute: WB: WB,1:500 - 1:1000