[KO Validated] RhoGDI Rabbit mAb, Clone: [ARC0629], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11556S
Article Name: [KO Validated] RhoGDI Rabbit mAb, Clone: [ARC0629], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11556S
Supplier Catalog Number: CNA11556S
Alternative Catalog Number: MBL-CNA11556S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565).
Conjugation: Unconjugated
Alternative Names: GDIA1, NPHS8, RHOGDI, RHOGDI-1, HEL-S-47e
Clonality: Monoclonal
Clone Designation: [ARC0629]
Molecular Weight: 23kDa
NCBI: 396
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG
Target: ARHGDIA
Application Dilute: WB: WB,1:500 - 1:1000