Glutathione Synthetase (GSS) Rabbit mAb, Clone: [ARC0630], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11557S
Article Name: Glutathione Synthetase (GSS) Rabbit mAb, Clone: [ARC0630], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11557S
Supplier Catalog Number: CNA11557S
Alternative Catalog Number: MBL-CNA11557S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637).
Conjugation: Unconjugated
Alternative Names: GSHS, HEL-S-64p, HEL-S-88n
Clonality: Monoclonal
Clone Designation: [ARC0630]
Molecular Weight: 52kDa
NCBI: 2937
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: AIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR
Target: GSS
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200