Calreticulin Rabbit mAb, Clone: [ARC0632], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11563P
Article Name: Calreticulin Rabbit mAb, Clone: [ARC0632], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11563P
Supplier Catalog Number: CNA11563P
Alternative Catalog Number: MBL-CNA11563P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1).
Conjugation: Unconjugated
Alternative Names: RO, CRT, SSA, cC1qR, HEL-S-99n
Clonality: Monoclonal
Clone Designation: [ARC0632]
Molecular Weight: 47kDa
NCBI: 811
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL
Target: CALR
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:100 - 1:500|IP,1:500 - 1:1000