hnRNP A1 Rabbit mAb, Clone: [ARC0633], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11564S
Article Name: hnRNP A1 Rabbit mAb, Clone: [ARC0633], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11564S
Supplier Catalog Number: CNA11564S
Alternative Catalog Number: MBL-CNA11564S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human hnRNP A1 (P09651).
Conjugation: Unconjugated
Alternative Names: UP 1, ALS19, ALS20, HNRPA1, IBMPFD3, HNRPA1L3, hnRNP A1, hnRNP-A1
Clonality: Monoclonal
Clone Designation: [ARC0633]
Molecular Weight: 39kDa
NCBI: 3178
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK
Target: HNRNPA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000