CHD4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11574S
Article Name: CHD4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11574S
Supplier Catalog Number: CNA11574S
Alternative Catalog Number: MBL-CNA11574S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1690 of human CHD4 (NP_001264.2).
Conjugation: Unconjugated
Alternative Names: CHD-4, Mi-2b, SIHIWES, Mi2-BETA
Clonality: Polyclonal
Molecular Weight: 218kDa
NCBI: 1108
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKK
Target: CHD4
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200