EGFR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11575S
Article Name: EGFR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11575S
Supplier Catalog Number: CNA11575S
Alternative Catalog Number: MBL-CNA11575S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 960-1060 of human EGFR (NP_005219.2).
Conjugation: Unconjugated
Alternative Names: ERBB, ERRP, HER1, mENA, ERBB1, PIG61, NISBD2
Clonality: Polyclonal
Molecular Weight: 134kDa
NCBI: 1956
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPI
Target: EGFR
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200