BCL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11582T
Article Name: BCL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11582T
Supplier Catalog Number: CNA11582T
Alternative Catalog Number: MBL-CNA11582T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2).
Conjugation: Unconjugated
Alternative Names: BCL4, D19S37
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 602
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
Target: BCL3
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200