MAP3K14 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11585P
Article Name: MAP3K14 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11585P
Supplier Catalog Number: CNA11585P
Alternative Catalog Number: MBL-CNA11585P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 330-662 of human MAP3K14 (NP_003945.2).
Conjugation: Unconjugated
Alternative Names: HS, NIK, HSNIK, FTDCR1B
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 9020
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KFSVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSC
Target: MAP3K14
Application Dilute: WB: WB,1:100 - 1:500