HEPACAM Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11589T
Article Name: HEPACAM Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11589T
Supplier Catalog Number: CNA11589T
Alternative Catalog Number: MBL-CNA11589T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-245 of human HEPACAM (NP_689935.2).
Conjugation: Unconjugated
Alternative Names: HEPN1, MLC2A, MLC2B, GlialCAM
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 220296
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSSLYIIL
Target: HEPACAM
Application Dilute: WB: WB,1:500 - 1:2000