Bcl-W Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1158P
| Article Name: |
Bcl-W Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA1158P |
| Supplier Catalog Number: |
CNA1158P |
| Alternative Catalog Number: |
MBL-CNA1158P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-W (NP_004041.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
BCLW, BCL-W, PPP1R51, BCL2-L-2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
21kDa |
| NCBI: |
599 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF |
| Target: |
BCL2L2 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
