Lumican (LUM) Rabbit mAb, Clone: [ARC0637], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11593S
Article Name: Lumican (LUM) Rabbit mAb, Clone: [ARC0637], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11593S
Supplier Catalog Number: CNA11593S
Alternative Catalog Number: MBL-CNA11593S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 212-350 of human Lumican (LUM) (P51884).
Conjugation: Unconjugated
Alternative Names: LDC, SLRR2D
Clonality: Monoclonal
Clone Designation: [ARC0637]
Molecular Weight: 38kDa
NCBI: 4060
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Target: LUM
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200