GREM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11595T
Article Name: GREM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11595T
Supplier Catalog Number: CNA11595T
Alternative Catalog Number: MBL-CNA11595T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1).
Conjugation: Unconjugated
Alternative Names: DRM, HMPS, MPSH, PIG2, CRAC1, CRCS4, DAND2, HMPS1, IHG-2, DUP15q, C15DUPq, GREMLIN, CKTSF1B1
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 26585
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD
Target: GREM1
Application Dilute: WB: WB,1:500 - 1:2000