CXCR3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11601P
| Article Name: |
CXCR3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11601P |
| Supplier Catalog Number: |
CNA11601P |
| Alternative Catalog Number: |
MBL-CNA11601P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human CXCR3 (NP_001495.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
GPR9, MigR, CD182, CD183, Mig-R, CKR-L2, CMKAR3, IP10-R |
| Clonality: |
Polyclonal |
| Molecular Weight: |
41kDa |
| NCBI: |
2833 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR |
| Target: |
CXCR3 |
| Application Dilute: |
WB: WB,1:100 - 1:500 |
