MAGEA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11607T
Article Name: MAGEA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11607T
Supplier Catalog Number: CNA11607T
Alternative Catalog Number: MBL-CNA11607T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 28-317 of human MAGEA4 (NP_002353.3).
Conjugation: Unconjugated
Alternative Names: CT1.4, MAGE4, MAGE4A, MAGE4B, MAGE-41, MAGE-X2
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 4103
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALAE
Target: MAGEA4
Application Dilute: WB: WB,1:500 - 1:2000