Albumin Rabbit mAb, Clone: [ARC0647], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11625S
| Article Name: |
Albumin Rabbit mAb, Clone: [ARC0647], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA11625S |
| Supplier Catalog Number: |
CNA11625S |
| Alternative Catalog Number: |
MBL-CNA11625S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Bovine, Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of bovine Serum Albumin / BSA (P02769). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Serum albumin, GIG20, GIG42, |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0647] |
| Molecular Weight: |
69kDa |
| NCBI: |
280717 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
KVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC |
| Target: |
ALB |
| Application Dilute: |
WB: WB,1:2000 - 1:10000 |
