OCIAD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11630T
Article Name: OCIAD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11630T
Supplier Catalog Number: CNA11630T
Alternative Catalog Number: MBL-CNA11630T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human OCIAD1 (NP_060300.1).
Conjugation: Unconjugated
Alternative Names: OCIA, ASRIJ, TPA018
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 54940
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Target: OCIAD1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200