COX IV Rabbit mAb, Clone: [ARC2518], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11631S
Article Name: COX IV Rabbit mAb, Clone: [ARC2518], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11631S
Supplier Catalog Number: CNA11631S
Alternative Catalog Number: MBL-CNA11631S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human COX IV (P13073).
Conjugation: Unconjugated
Alternative Names: COX4, COXIV, COX4-1, COXIV-1, MC4DN16, COX IV-1
Clonality: Monoclonal
Clone Designation: [ARC2518]
Molecular Weight: 20kDa
NCBI: 1327
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEW
Target: COX4I1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200