GABRA3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11636T
Article Name: GABRA3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11636T
Supplier Catalog Number: CNA11636T
Alternative Catalog Number: MBL-CNA11636T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-276 of human GABRA3 (NP_000799.1).
Conjugation: Unconjugated
Alternative Names: EPILX2
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 2556
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIG
Target: GABRA3
Application Dilute: WB: WB,1:500 - 1:2000