Kininogen 1 (KNG1) Rabbit mAb, Clone: [ARC0653], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11638S
Article Name: Kininogen 1 (KNG1) Rabbit mAb, Clone: [ARC0653], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11638S
Supplier Catalog Number: CNA11638S
Alternative Catalog Number: MBL-CNA11638S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1).
Conjugation: Unconjugated
Alternative Names: BK, HK, BDK, KNG, HAE6, HMWK
Clonality: Monoclonal
Clone Designation: [ARC0653]
Molecular Weight: 44kDa/48kDa/72kDa
NCBI: 3827
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS
Target: KNG1
Application Dilute: WB: WB,1:500 - 1:1000