FKBP12 Rabbit mAb, Clone: [ARC0654], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11641S
Article Name: FKBP12 Rabbit mAb, Clone: [ARC0654], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11641S
Supplier Catalog Number: CNA11641S
Alternative Catalog Number: MBL-CNA11641S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942).
Conjugation: Unconjugated
Alternative Names: FKBP1, PKC12, PKCI2, FKBP12, PPIASE, FKBP-12, FKBP-1A
Clonality: Monoclonal
Clone Designation: [ARC0654]
Molecular Weight: 12kDa
NCBI: 2280
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Target: FKBP1A
Application Dilute: WB: WB,1:500 - 1:1000