GluR1/GRIA1 Rabbit mAb, Clone: [ARC0657], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11643S
Article Name: GluR1/GRIA1 Rabbit mAb, Clone: [ARC0657], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11643S
Supplier Catalog Number: CNA11643S
Alternative Catalog Number: MBL-CNA11643S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261).
Conjugation: Unconjugated
Alternative Names: GLUH1, GLUR1, GLURA, GluA1, HBGR1, MRD67, MRT76
Clonality: Monoclonal
Clone Designation: [ARC0657]
Molecular Weight: 102kDa
NCBI: 2890
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Target: GRIA1
Application Dilute: WB: WB,1:500 - 1:2000