PAK4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11646T
Article Name: PAK4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11646T
Supplier Catalog Number: CNA11646T
Alternative Catalog Number: MBL-CNA11646T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PAK4 (NP_005875.1).
Conjugation: Unconjugated
Alternative Names: PAK4
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 10298
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLD
Target: PAK4
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200