SLC6A5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11647T
Article Name: SLC6A5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11647T
Supplier Catalog Number: CNA11647T
Alternative Catalog Number: MBL-CNA11647T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3).
Conjugation: Unconjugated
Alternative Names: NET1, GLYT2, HKPX3, GLYT-2
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 9152
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF
Target: SLC6A5
Application Dilute: WB: WB,1:500 - 1:2000