APOBEC3D Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11648T
Article Name: APOBEC3D Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11648T
Supplier Catalog Number: CNA11648T
Alternative Catalog Number: MBL-CNA11648T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human APOBEC3D (NP_689639.2).
Conjugation: Unconjugated
Alternative Names: A3D, A3DE, ARP6, APOBEC3E, APOBEC3DE
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 140564
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ
Target: APOBEC3D
Application Dilute: WB: WB,1:500 - 1:2000