[KO Validated] CDKN2A/p16INK4a Rabbit mAb, Clone: [ARC0661], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11651S
Article Name: [KO Validated] CDKN2A/p16INK4a Rabbit mAb, Clone: [ARC0661], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11651S
Supplier Catalog Number: CNA11651S
Alternative Catalog Number: MBL-CNA11651S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 57-156 of human CDKN2A/p16INK4a (P42771).
Conjugation: Unconjugated
Alternative Names: ARF, MLM, P14, P16, P19, CMM2, INK4, MTS1, TP16, CDK4I, CDKN2, INK4A, MTS-1, P14ARF, P19ARF, P16INK4, P16INK4A, P16-INK4A
Clonality: Monoclonal
Clone Designation: [ARC0661]
Molecular Weight: 17kDa
NCBI: 1029
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Target: CDKN2A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200