HB-EGF Rabbit mAb, Clone: [ARC0663], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11657S
Article Name: HB-EGF Rabbit mAb, Clone: [ARC0663], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11657S
Supplier Catalog Number: CNA11657S
Alternative Catalog Number: MBL-CNA11657S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075).
Conjugation: Unconjugated
Alternative Names: DTR, DTS, DTSF, HEGFL
Clonality: Monoclonal
Clone Designation: [ARC0663]
Molecular Weight: 23kDa
NCBI: 1839
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPV
Target: HBEGF
Application Dilute: WB: WB,1:500 - 1:2000