FBP1 Rabbit mAb, Clone: [ARC0664], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11664S
Article Name: FBP1 Rabbit mAb, Clone: [ARC0664], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11664S
Supplier Catalog Number: CNA11664S
Alternative Catalog Number: MBL-CNA11664S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 239-338 of human FBP1 (P09467).
Conjugation: Unconjugated
Alternative Names: FBP
Clonality: Monoclonal
Clone Designation: [ARC0664]
Molecular Weight: 37kDa
NCBI: 2203
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ
Target: FBP1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200