CD168/RHAMM Rabbit mAb, Clone: [ARC0667], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11666S
Article Name: CD168/RHAMM Rabbit mAb, Clone: [ARC0667], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11666S
Supplier Catalog Number: CNA11666S
Alternative Catalog Number: MBL-CNA11666S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD168/RHAMM (O75330).
Conjugation: Unconjugated
Alternative Names: CD168, IHABP, RHAMM
Clonality: Monoclonal
Clone Designation: [ARC0667]
Molecular Weight: 84kDa
NCBI: 3161
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGA
Target: HMMR
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200