CD13/ANPEP Rabbit mAb, Clone: [ARC0670], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11669S
Article Name: CD13/ANPEP Rabbit mAb, Clone: [ARC0670], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11669S
Supplier Catalog Number: CNA11669S
Alternative Catalog Number: MBL-CNA11669S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CD13/ANPEP (P15144).
Conjugation: Unconjugated
Alternative Names: APN, AP-M, AP-N, CD13, LAP1, P150, PEPN, hAPN, GP150
Clonality: Monoclonal
Clone Designation: [ARC0670]
Molecular Weight: 110kDa
NCBI: 290
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: NAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA
Target: ANPEP
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200