SMPD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1166T
Article Name: SMPD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1166T
Supplier Catalog Number: CNA1166T
Alternative Catalog Number: MBL-CNA1166T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMPD2 (NP_003071.2).
Conjugation: Unconjugated
Alternative Names: ISC1, NSMASE, NSMASE1
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 6610
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYI
Target: SMPD2
Application Dilute: WB: WB,1:500 - 1:2000