OLA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11671T
Article Name: OLA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11671T
Supplier Catalog Number: CNA11671T
Alternative Catalog Number: MBL-CNA11671T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human OLA1 (NP_037473.3).
Conjugation: Unconjugated
Alternative Names: DOC45, GBP45, GTBP9, GTPBP9, PTD004
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 29789
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT
Target: OLA1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200