IGFBP1 Rabbit mAb, Clone: [ARC0671], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA11672S
Article Name: |
IGFBP1 Rabbit mAb, Clone: [ARC0671], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA11672S |
Supplier Catalog Number: |
CNA11672S |
Alternative Catalog Number: |
MBL-CNA11672S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 160-259 of human IGFBP1 (P08833). |
Conjugation: |
Unconjugated |
Alternative Names: |
AFBP, IBP1, PP12, IGF-BP25, hIGFBP-1 |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0671] |
Molecular Weight: |
28kDa |
NCBI: |
3484 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
Target: |
IGFBP1 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |