CD127/IL7R Rabbit mAb, Clone: [ARC0672], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11678S
Article Name: CD127/IL7R Rabbit mAb, Clone: [ARC0672], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11678S
Supplier Catalog Number: CNA11678S
Alternative Catalog Number: MBL-CNA11678S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871).
Conjugation: Unconjugated
Alternative Names: ILRA, CD127, IL7RA, CDW127, IMD104, sIL-7R, lnc-IL7R, IL7Ralpha, IL-7Ralpha, IL-7R-alpha
Clonality: Monoclonal
Clone Designation: [ARC0672]
Molecular Weight: 52kDa
NCBI: 3575
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHV
Target: IL7R
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200