Zinc-alpha2-glycoprotein (ZAG/AZGP1) Rabbit mAb, Clone: [ARC0673], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11680S
Article Name: Zinc-alpha2-glycoprotein (ZAG/AZGP1) Rabbit mAb, Clone: [ARC0673], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11680S
Supplier Catalog Number: CNA11680S
Alternative Catalog Number: MBL-CNA11680S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Zinc-alpha2-glycoprotein (ZAG/AZGP1) (P25311).
Conjugation: Unconjugated
Alternative Names: ZAG, ZA2G
Clonality: Monoclonal
Clone Designation: [ARC0673]
Molecular Weight: 34kDa
NCBI: 563
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMET
Target: AZGP1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200