LIMA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11682T
Article Name: LIMA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11682T
Supplier Catalog Number: CNA11682T
Alternative Catalog Number: MBL-CNA11682T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 560-759 of human LIMA1 (NP_057441.1).
Conjugation: Unconjugated
Alternative Names: EPLIN, LDLCQ8, SREBP3
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 51474
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DEISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSVKSPKTVSPPIRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGNVGKTTWQNKESKGETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQEPKSLNWSSFVDNTFAEEFTTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE
Target: LIMA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200