Na+/K+-ATPase Rabbit mAb, Clone: [ARC0674], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11683S
Article Name: Na+/K+-ATPase Rabbit mAb, Clone: [ARC0674], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11683S
Supplier Catalog Number: CNA11683S
Alternative Catalog Number: MBL-CNA11683S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Na+/K+-ATPase (P05023).
Conjugation: Unconjugated
Alternative Names: CMT2DD, HOMGSMR2
Clonality: Monoclonal
Clone Designation: [ARC0674]
Molecular Weight: 113kDa
NCBI: 476
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Target: ATP1A1
Application Dilute: WB: WB,1:10000 - 1:120000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200