Glypican 3 (GPC3) Rabbit mAb, Clone: [ARC0675], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11686S
Article Name: Glypican 3 (GPC3) Rabbit mAb, Clone: [ARC0675], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11686S
Supplier Catalog Number: CNA11686S
Alternative Catalog Number: MBL-CNA11686S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-211 of human Glypican 3 (GPC3) (P51654).
Conjugation: Unconjugated
Alternative Names: SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
Clonality: Monoclonal
Clone Designation: [ARC0675]
Molecular Weight: 66kDa
NCBI: 2719
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNF
Target: GPC3
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200