SLC25A12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11688T
Article Name: SLC25A12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11688T
Supplier Catalog Number: CNA11688T
Alternative Catalog Number: MBL-CNA11688T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC25A12 (NP_003696.2).
Conjugation: Unconjugated
Alternative Names: AGC1, DEE39, ARALAR, EIEE39
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 8604
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
Target: SLC25A12
Application Dilute: WB: WB,1:500 - 1:2000