GAS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1168S
Article Name: GAS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1168S
Supplier Catalog Number: CNA1168S
Alternative Catalog Number: MBL-CNA1168S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1).
Conjugation: Unconjugated
Alternative Names: GAS-2
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 2620
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT
Target: GAS2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200