SERCA2/ATP2A2 Rabbit mAb, Clone: [ARC0679], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11692S
Article Name: SERCA2/ATP2A2 Rabbit mAb, Clone: [ARC0679], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11692S
Supplier Catalog Number: CNA11692S
Alternative Catalog Number: MBL-CNA11692S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 943-1042 of human SERCA2/ATP2A2 (P16615).
Conjugation: Unconjugated
Alternative Names: DD, DAR, ATP2B, SERCA2
Clonality: Monoclonal
Clone Designation: [ARC0679]
Molecular Weight: 115kDa
NCBI: 488
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: HFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVLLIMPLVIWVYSTDTNFSDMFWS
Target: ATP2A2
Application Dilute: WB: WB,1:500 - 1:2000|IP,1:1000 - 1:5000