MTSS1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11697T
Article Name: MTSS1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11697T
Supplier Catalog Number: CNA11697T
Alternative Catalog Number: MBL-CNA11697T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3).
Conjugation: Unconjugated
Alternative Names: MIM, MIMA, MIMB
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 9788
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED
Target: MTSS1
Application Dilute: WB: WB,1:500 - 1:2000