HSP47/SERPINH1 Rabbit mAb, Clone: [ARC0681], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11698S
Article Name: HSP47/SERPINH1 Rabbit mAb, Clone: [ARC0681], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11698S
Supplier Catalog Number: CNA11698S
Alternative Catalog Number: MBL-CNA11698S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454).
Conjugation: Unconjugated
Alternative Names: CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2
Clonality: Monoclonal
Clone Designation: [ARC0681]
Molecular Weight: 46kDa
NCBI: 871
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Target: SERPINH1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200